PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 355aa    MW: 40193.1 Da    PI: 6.9005
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038436.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.82.9e-55161421129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL +kv ++ + + ++i evd++k+ePwdLp k+k +ekewyfF+ +d+ky+tg r+nrat++gyWkatgkdke+++  ++
  Pbr038436.1  16 LPPGFRFHPTDEELLSHYLSPKVLDNFFCA-RAIGEVDLNKCEPWDLPWKAKMGEKEWYFFCVKDRKYPTGLRTNRATEAGYWKATGKDKEIYK-AKT 111
                  79************************9888.89***************888999****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfy+grapkg+kt+Wvmheyrle
  Pbr038436.1 112 LVGMKKTLVFYTGRAPKGVKTNWVMHEYRLE 142
                  *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6412166IPR003441NAC domain
PROSITE profilePS5100559.20716166IPR003441NAC domain
PfamPF023651.1E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MENTSGFIME DEKMELPPGF RFHPTDEELL SHYLSPKVLD NFFCARAIGE VDLNKCEPWD  60
LPWKAKMGEK EWYFFCVKDR KYPTGLRTNR ATEAGYWKAT GKDKEIYKAK TLVGMKKTLV  120
FYTGRAPKGV KTNWVMHEYR LEGESSTHNL PKTAKNEWVI CRIFQKSSGG KKTHISGLLR  180
PSPFGNELRS SLLPPLMDSP AYNSDARTTA TACETSHVSC FSDPAEDQKT EDDIMDSFNN  240
SYNHQHHHHH NNIHFASSSR SNPSAHLNSF YSNQIPPNVG LLHHQNLVLM QNPSLLTMLV  300
ENHAPNLRHS AKIEFSPDTG LSIDASSVVS NREMVQDDPS YSSAPIELDG LWNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-561317214171NO APICAL MERISTEM PROTEIN
1ut4_B6e-561317214171NO APICAL MERISTEM PROTEIN
1ut7_A6e-561317214171NO APICAL MERISTEM PROTEIN
1ut7_B6e-561317214171NO APICAL MERISTEM PROTEIN
4dul_A6e-561317214171NAC domain-containing protein 19
4dul_B6e-561317214171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1774230.0FJ177423.1 Malus x domestica NAC domain protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360607.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-127NC100_ARATH; NAC domain-containing protein 100
TrEMBLB6DXL40.0B6DXL4_MALDO; NAC domain class transcription factor
STRINGVIT_14s0108g01070.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-127NAC domain containing protein 100